Favicon of oiv.int Oiv.int OIV - International Organisation of Vine and Wine


Visit Site

About oiv.int

The domain name has registered. TLD (Top level domain) of the domain name is int and SLD (Second level domain) length equals to 3.. It's seems appropriate for SEO and human-memorability. Domain name choosing is important to maximize search engine-referred traffic.

We haven't dedected registrant information. For further raw whois information please take a look at the Whois section.

It has a pagerank of 6.

It has a alexarank of 398247.

oiv.int's A record assigned to . if you want to see such as Name Server, CNAME, MX etc. please look at the DNS section. More oiv.int DNS information may be found in

Last Reload: 1 years ago

IP Address:
Country: France (FR)
Page Speed: 37%
Domain Age: 16
Created Date: 10-09-2001
Updated Date: 14-05-2012
Meta Title: OIV - International Organisation of Vine and Wine
Meta Description:
Meta Keywords:

Server Location

Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host oiv.int . Currently, hosted in France and its service provider is OVH SAS .

Latitude: 50.633
Longitude: 3.0586
Timezone: Europe/Paris
Country: France (FR)
City: Lille
Region: Nord-Pas-de-Calais
Region Code: B4
Postal Code: 59800

DNS Records

Basicly, DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses. Example, A record indicates you which ip address will resolve when you access to oiv.int on the browser.

Host Type TTL Class Other
oiv.int. SOA 599 IN ns1.dynafi.fr. hostmaster\@dynafi.fr. 2017031501 86400 21600 2419200 86400
oiv.int. NS 599 IN ns2.dynafi.fr.
oiv.int. NS 599 IN ns1.dynafi.fr.
oiv.int. MX 599 IN 5 aldaran.mailinblack.com.
oiv.int. MX 599 IN 100 mx0.mailinblack.com.
oiv.int. A 599 IN

Heading Analysis

International Organisation of Vine and Wine
Table and Dried Grapes: World data available
Stay in touch
6th symposium Oenoviti
Enoforum 2017
40th World Congress of Vine and Wine
Standards and technical documents
Databases and Statistics

Whois Information

Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;

  • Its name servers are; ns1.dynafi.fr ns2.dynafi.fr

Registrant Organization: Organisation International de la Vigne et DuVin
Created Date: Monday, September 10th, 2001
Updated Date: Monday, May 14th, 2012
Admin Name: Federico CASTELLUCCI
Technical Name: Sylvain PASSEMAR

HTTP Header Analysis

HTTP Header information is a part of HTTP protocol that a user's browser sends to called Apache containing the details of what the browser wants and will accept back from the web server.

Status-Code: 200
Response Time: 589
Date Sun, 14 May 2017 06:48:20 GMT
Server Apache
Set-Cookie PHPSESSID=mkg6rbgagir5gtnpp0nedkkvl7; path=/
Expires Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma no-cache
Vary Accept-Encoding
Content-Encoding gzip
Keep-Alive timeout=15, max=100
Connection Keep-Alive
Content-Type text/html; charset=utf-8
Go to top


Websites which similar to Oiv

Favicon of oiv.dk Oiv.dk Motion
Favicon of oiv.hr Oiv.hr Not Found
Favicon of oiv.eu Oiv.eu oiv.eu - This website is for sale! - oiv Resources and Information.
Favicon of oiv.de Oiv.de
Favicon of oiv.cc Oiv.cc oiv.cc
Favicon of oiv.ir Oiv.ir این سایت (دامنه) به فروش میرسد
Favicon of oiv.biz Oiv.biz 餐厅大理石装修效果图 - 石材, 石砖O2O, 互联网+奢石, 大理石家装
Favicon of oiv.com Oiv.com
Favicon of oiv.com.cn Oiv.com.cn oiv.com.cn - The domain is available for purchase
Favicon of oiv.cn Oiv.cn oiv.cn


The following list shows you to spelling mistakes possible of the internet users for the website searched oiv.int.

  • iv.int
  • ooiv.int
  • piv.int
  • poiv.int
  • opiv.int
  • iiv.int
  • ioiv.int
  • oiiv.int
  • kiv.int
  • koiv.int
  • okiv.int
  • liv.int
  • loiv.int
  • oliv.int
  • 0iv.int
  • 0oiv.int
  • o0iv.int
  • :iv.int
  • :oiv.int
  • o:iv.int
  • 9iv.int
  • 9oiv.int
  • o9iv.int
  • ov.int
  • oiiv.int
  • ouv.int
  • ouiv.int
  • oiuv.int
  • o8v.int
  • o8iv.int
  • oi8v.int
  • o*v.int
  • o*iv.int
  • oi*v.int
  • okv.int
  • okiv.int
  • oikv.int
  • olv.int
  • oliv.int
  • oilv.int
  • oov.int
  • ooiv.int
  • oiov.int
  • ojv.int
  • ojiv.int
  • oijv.int
  • o9v.int
  • o9iv.int
  • oi9v.int
  • iov.int
  • oi.int
  • oivv.int
  • oih.int
  • oihv.int
  • oivh.int
  • oic.int
  • oicv.int
  • oivc.int
  • oi .int
  • oi v.int
  • oiv .int
  • oib.int
  • oibv.int
  • oivb.int
  • oif.int
  • oifv.int
  • oivf.int
  • oig.int
  • oigv.int
  • oivg.int
  • ovi.int
  • oivint
  • oiv..int
  • oiv/int
  • oiv/.int
  • oiv./int
  • oivnint
  • oivn.int
  • oiv.nint
  • oiv;int
  • oiv;.int
  • oiv.;int
  • oivlint
  • oivl.int
  • oiv.lint
  • oiv int
  • oiv .int
  • oiv. int
  • oiv,int
  • oiv,.int
  • oiv.,int
  • oivmint
  • oivm.int
  • oiv.mint
  • oi.vint
  • oiv.nt
  • oiv.iint
  • oiv.unt
  • oiv.uint
  • oiv.iunt
  • oiv.8nt
  • oiv.8int
  • oiv.i8nt
  • oiv.*nt
  • oiv.*int
  • oiv.i*nt
  • oiv.knt
  • oiv.kint
  • oiv.iknt
  • oiv.lnt
  • oiv.lint
  • oiv.ilnt
  • oiv.ont
  • oiv.oint
  • oiv.iont
  • oiv.jnt
  • oiv.jint
  • oiv.ijnt
  • oiv.9nt
  • oiv.9int
  • oiv.i9nt
  • oivi.nt
  • oiv.it
  • oiv.innt
  • oiv.ibt
  • oiv.ibnt
  • oiv.inbt
  • oiv.i t
  • oiv.i nt
  • oiv.in t
  • oiv.ikt
  • oiv.iknt
  • oiv.inkt
  • oiv.imt
  • oiv.imnt
  • oiv.inmt
  • oiv.iht
  • oiv.ihnt
  • oiv.inht
  • oiv.ijt
  • oiv.ijnt
  • oiv.injt
  • oiv.nit
  • oiv.in
  • oiv.intt
  • oiv.inf
  • oiv.inft
  • oiv.intf
  • oiv.in5
  • oiv.in5t
  • oiv.int5
  • oiv.inh
  • oiv.inht
  • oiv.inth
  • oiv.ing
  • oiv.ingt
  • oiv.intg
  • oiv.iny
  • oiv.inyt
  • oiv.inty
  • oiv.in6
  • oiv.in6t
  • oiv.int6
  • oiv.inr
  • oiv.inrt
  • oiv.intr
  • oiv.itn
Show All Mistakes All Mistakes

Related searches

MORFOSnetworkshayri cigratadownload vidio ATASHA6.COMindinapondss.e.pe. cita previawww.goldcommdity.comBatthpalsacinrmabisnis2122.resjult klMp3musicdoanloader.Comwhat is STDw95www.doggysxe.comboquiner re 7 carroallsangel.comgotiya.comWww. Goesyearn .comvideoup net searchhxmovies.net movies donlowdmyplaywinlucky0penricejachba facemo3taklejenyawap.comsatta skinjaXmasher. Comhttp://.www.xnxcor/google.comfootball zone ucweb liga championerbarimt.mnserati 9appsvn thoi su bplaced nettubidy.colnsdln.comtoptubr69sanulcomxdanchoi.comretmlab montagni4everprocxywww.justrockgladsone.org..comwww.saajncomtransentrwffmiddle east consultants.co.ugasmis dfhapplychickwww.hslb.go.tzlacodadelghiro78dekacrisoffnerwww.badrflim.comwww.srunegocio .com.brparmeshardearbahatika 52 coming onilne nlwhat is appetitase Asite yootara[email protected] enjsest hikaye mondo pesca cervignanoirda new syllabus ic38videoup.net nsatta.62.26brazsers hd .comwww.aimlchl.HELPBD24.COM9xodownloads.comtTamron AF 70-300mm F/4-5.6 Di standard lens meansKarbonTabelt"*@fad.gov.ae"Blechbearbeitung,Dranskenatureguidance.com japandhooliwap.comSite:www.mcbrasil.comManuel Zemskykenh69xinyaarwandahankaweeklysemihayanklhttp:/webmail.veticare.nlabroncoltamilyogi tv