About paunite.org

The domain name has registered. TLD (Top level domain) of the domain name is org and SLD (Second level domain) length equals to 7.. It's seems appropriate for SEO and human-memorability. Domain name choosing is important to maximize search engine-referred traffic.

paunite.org was created by Contact Privacy Inc. Customer 0114054009 on 16/01/2007 . For further raw whois information please take a look at the Whois section.

It has a pagerank of 4.

paunite.org's A record assigned to . if you want to see such as Name Server, CNAME, MX etc. please look at the DNS section. More paunite.org DNS information may be found in

Last Reload: 2 years ago

IP Address:
Country: United States (US)
Domain Age: 9
Created Date: 16-01-2007
Updated Date: 11-08-2015
Expired Date: 16-01-2018
Meta Title: Home

Server Location

Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host paunite.org . Currently, hosted in United States and its service provider is .

Latitude: 42.5051
Longitude: -71.2047
Timezone: America/New_York
Country: United States (US)
City: Burlington
Region: Massachusetts
Region Code: MA
Postal Code: 01803

DNS Records

Basicly, DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses. Example, A record indicates you which ip address will resolve when you access to paunite.org on the browser.

Host Type TTL Class Other
paunite.org. TXT 3599 IN "v=spf1 ip4: ip4: ip4: ?all"
paunite.org. MX 3599 IN 30 mx.paunite.org.
paunite.org. NS 3599 IN ns2.powweb.com.
paunite.org. A 3599 IN
paunite.org. NS 3599 IN ns1.powweb.com.
paunite.org. SOA 3599 IN ns1.powweb.com. dnsadmin.powweb.com. 2007011666 10800 3600 604800 3600

Heading Analysis


Whois Information

Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;

  • The domain registered by Tucows Inc. .
  • paunite.org taken by Contact Privacy Inc. Customer 0114054009 on 16/01/2007 and it will expire on 16/01/2018 .
  • Its name servers are; ns1.powweb.com ns2.powweb.com

Registrar Name: Tucows Inc.
Registrant Name: Contact Privacy Inc. Customer 0114054009
Registrant Organization: Contact Privacy Inc. Customer 0114054009
Created Date: Tuesday, January 16th, 2007
Updated Date: Tuesday, August 11th, 2015
Expires Date: Tuesday, January 16th, 2018
Admin Name: Contact Privacy Inc. Customer 0114054009
Admin Organization: Contact Privacy Inc. Customer 0114054009
Technical Name: Contact Privacy Inc. Customer 0114054009
Technical Organization: Contact Privacy Inc. Customer 0114054009

HTTP Header Analysis

HTTP Header information is a part of HTTP protocol that a user's browser sends to called Apache/2 containing the details of what the browser wants and will accept back from the web server.

Status-Code: 200
Response Time: 1167
Date Sun, 10 Jan 2016 17:08:38 GMT
Content-Type text/html; charset=utf-8
Content-Length 27193
Connection keep-alive
Keep-Alive timeout=30
Server Apache/2
X-Powered-By PHP/5.3.29
Set-Cookie 3d62b3ef4c8f3f64a98bb7e0657ff753=3a757e7304147e6705c419d59c46768e; path=/ bt_arise_tpl=bt_arise; expires=Fri, 30-Dec-2016 17:08:37 GMT; path=/
Cache-Control private, no-cache
Pragma no-cache
Accept-Ranges bytes
Age 0
Go to top

Reverse Ip

Websites hosted with the same IP Address

Favicon of vietflash.net Vietflash.net Viet Flash Entertainment - Amy's Website - DeLuxe Weblink Portal
Favicon of boomboom.net Boomboom.net
Favicon of ilyaimy.com Ilyaimy.com Welcome to our noises.
Favicon of hrsu.org Hrsu.org Human Rights Society of Uzbekistan
Favicon of bizk.com Bizk.com
Favicon of doradodentalsupply.com Doradodentalsupply.com Dorado | Dorado Dental Supply, Inc.
Favicon of blwcampusministry.org Blwcampusministry.org
Favicon of bacchusimportersltd.com Bacchusimportersltd.com Bacchus Importers, Ltd.
Favicon of aramink.com Aramink.com
Favicon of vnlisting.com Vnlisting.com Vietnamese Business Directory - VNLISTING :: Community - Entertainment
More >>


The following list shows you to spelling mistakes possible of the internet users for the website searched paunite.org.

  • aunite.org
  • ppaunite.org
  • launite.org
  • lpaunite.org
  • plaunite.org
  • -aunite.org
  • -paunite.org
  • p-aunite.org
  • :aunite.org
  • :paunite.org
  • p:aunite.org
  • 0aunite.org
  • 0paunite.org
  • p0aunite.org
  • oaunite.org
  • opaunite.org
  • poaunite.org
  • punite.org
  • paaunite.org
  • pwunite.org
  • pwaunite.org
  • pawunite.org
  • pzunite.org
  • pzaunite.org
  • pazunite.org
  • psunite.org
  • psaunite.org
  • pasunite.org
  • pqunite.org
  • pqaunite.org
  • paqunite.org
  • apunite.org
  • panite.org
  • pauunite.org
  • pa7nite.org
  • pa7unite.org
  • pau7nite.org
  • pahnite.org
  • pahunite.org
  • pauhnite.org
  • paknite.org
  • pakunite.org
  • pauknite.org
  • pajnite.org
  • pajunite.org
  • paujnite.org
  • painite.org
  • paiunite.org
  • pauinite.org
  • pa8nite.org
  • pa8unite.org
  • pau8nite.org
  • paynite.org
  • payunite.org
  • pauynite.org
  • puanite.org
  • pauite.org
  • paunnite.org
  • paubite.org
  • paubnite.org
  • paunbite.org
  • pau ite.org
  • pau nite.org
  • paun ite.org
  • paukite.org
  • pauknite.org
  • paunkite.org
  • paumite.org
  • paumnite.org
  • paunmite.org
  • pauhite.org
  • pauhnite.org
  • paunhite.org
  • paujite.org
  • paujnite.org
  • paunjite.org
  • panuite.org
  • paunte.org
  • pauniite.org
  • paunute.org
  • paunuite.org
  • pauniute.org
  • paun8te.org
  • paun8ite.org
  • pauni8te.org
  • paun*te.org
  • paun*ite.org
  • pauni*te.org
  • paunkte.org
  • paunkite.org
  • paunikte.org
  • paunlte.org
  • paunlite.org
  • paunilte.org
  • paunote.org
  • paunoite.org
  • pauniote.org
  • paunjte.org
  • paunjite.org
  • paunijte.org
  • paun9te.org
  • paun9ite.org
  • pauni9te.org
  • pauinte.org
  • paunie.org
  • paunitte.org
  • paunife.org
  • paunifte.org
  • paunitfe.org
  • pauni5e.org
  • pauni5te.org
  • paunit5e.org
  • paunihe.org
  • paunihte.org
  • paunithe.org
  • paunige.org
  • paunigte.org
  • paunitge.org
  • pauniye.org
  • pauniyte.org
  • paunitye.org
  • pauni6e.org
  • pauni6te.org
  • paunit6e.org
  • paunire.org
  • paunirte.org
  • paunitre.org
  • pauntie.org
  • paunit.org
  • paunitee.org
  • paunit3.org
  • paunit3e.org
  • paunite3.org
  • paunitw.org
  • paunitwe.org
  • paunitew.org
  • paunits.org
  • paunitse.org
  • paunites.org
  • paunit#.org
  • paunit#e.org
  • paunite#.org
  • paunitd.org
  • paunitde.org
  • paunited.org
  • paunitf.org
  • paunitfe.org
  • paunitef.org
  • paunit&.org
  • paunit&e.org
  • paunite&.org
  • paunitr.org
  • paunitre.org
  • pauniter.org
  • paunit4.org
  • paunit4e.org
  • paunite4.org
  • pauniet.org
  • pauniteorg
  • paunite..org
  • paunite/org
  • paunite/.org
  • paunite./org
  • paunitenorg
  • pauniten.org
  • paunite.norg
  • paunite;org
  • paunite;.org
  • paunite.;org
  • paunitelorg
  • paunitel.org
  • paunite.lorg
  • paunite org
  • paunite .org
  • paunite. org
  • paunite,org
  • paunite,.org
  • paunite.,org
  • paunitemorg
  • paunitem.org
  • paunite.morg
  • paunit.eorg
  • paunite.rg
  • paunite.oorg
  • paunite.prg
  • paunite.porg
  • paunite.oprg
  • paunite.irg
  • paunite.iorg
  • paunite.oirg
  • paunite.krg
  • paunite.korg
  • paunite.okrg
  • paunite.lrg
  • paunite.lorg
  • paunite.olrg
  • paunite.0rg
  • paunite.0org
  • paunite.o0rg
  • paunite.:rg
  • paunite.:org
  • paunite.o:rg
  • paunite.9rg
  • paunite.9org
  • paunite.o9rg
  • pauniteo.rg
  • paunite.og
  • paunite.orrg
  • paunite.o4g
  • paunite.o4rg
  • paunite.or4g
  • paunite.odg
  • paunite.odrg
  • paunite.ordg
  • paunite.ogg
  • paunite.ogrg
  • paunite.orgg
  • paunite.oeg
  • paunite.oerg
  • paunite.oreg
  • paunite.otg
  • paunite.otrg
  • paunite.ortg
  • paunite.ofg
  • paunite.ofrg
  • paunite.orfg
  • paunite.o5g
  • paunite.o5rg
  • paunite.or5g
  • paunite.rog
  • paunite.or
  • paunite.orgg
  • paunite.ory
  • paunite.oryg
  • paunite.orgy
  • paunite.orr
  • paunite.orrg
  • paunite.orgr
  • paunite.orh
  • paunite.orhg
  • paunite.orgh
  • paunite.orf
  • paunite.orfg
  • paunite.orgf
  • paunite.ort
  • paunite.ortg
  • paunite.orgt
  • paunite.orv
  • paunite.orvg
  • paunite.orgv
  • paunite.orb
  • paunite.orbg
  • paunite.orgb
  • paunite.ogr
Show All Mistakes All Mistakes

Related searches

Mobile Livescore/21-09-2016powercef tm1gBausanierung,Warsownayaecamwallpapertmoviedoodhwawali. commaitreyaplootters.com"*@casonsrentacar.com"http://1storm.ru/www/carterfuneralhome.comweddingasongs.pkAnimeehntaigeekpanterzasnomi f3mminiliwww.kuttywapncomgoregrishwww.magdawasizek.debhoot fktorrentgear.orgbdmusic99.linwhatiscockfrottageRirmata istanbulfilmAsqkijapan sunami.commamualidadespasoapasoebooks it .orggarottasbharkocevicrozan8eclatest loaadshedding routinewww.X Nasran.comwww.liveswireorg.inHotgvideos.comatmourstone stoneeps turbolGoe;lgoocommorochopergayfuckxvideosibـkiu ـ asluvqponramiy .composemotomelecrrosteelcastingsxass hamsterwww.lenasalon.comkahsta question paper wcimtganool21.comwww.avtkhyber.tvemail @bdoindiaco.inmynamespics.birthday.comyoxoshopxhumsetr.cinclashpfclanshack.spacecheqtingwifevideos.ordm.fonbet.1compba nekretninedoopkudu.comtijkaphotoinsyt mobi.coma-ah33.comz4turf pmuGaYRuYSwanzk xxci159 .comwww.cvarbe.commp4movhies.comrekyanal.comRadio Natagala 94.7, José María Paz 785, H3500CCO Resistencia, Chacovlab hklive mobile mode sbilatinmecosbirroteca old alenujjetz.com unblockerm.m.canlıskorOnlagump3.website108.20 to movie dowmliadmymagftiphimkhonhche33.ซื้อหวยcrosd culturetabellonifinali ipsia nuoro 2015/16www.webemuic. in http://1storm.ru/www/ring2mob.com#KanauiManiaforextrande"*@tct.gov.za"berand shos x.B.R.A.N.D.comwww.agrikuop.nic.comGloryhold initiation.com키스방검색swaud dwaudmailforexchamnge[email protected]